{"product_id":"proteintech-11336-1-ap","title":"Proteintech, 11336-1-AP, CBFA2T2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CBFA2T2 (11336-1-AP) by Proteintech is a Polyclonal antibody targeting CBFA2T2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11336-1-AP targets CBFA2T2 in WB, IHC, chIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  HeLa cells,  mouse testis tissue\nPositive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCore-binding factor, runt domain, alpha subunit 2, translocated to 2(CBFA2T2) belongs to a family of ubiquitously expressed transcriptional repressors that interact with transcription factors bound to promoters of target genes and with histone deacetylases (HDACs) critical for enforcement of repressor function.CBFA2T2, also named as MTGR1 or  EHT, is an 85-kDa phosphoprotein. It can bind AML1-MTG8 fusion protein in acute myeloid leukemia. The binding leads to an enhancement of cell proliferation mediated in a murine myeloid model. The calculated molecular weight of CBFA2T2 is 67 kDa, but modified SMARCE1 is about 80 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1880 Product name: Recombinant human CBFA2T2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-263 aa of BC015066 Sequence: MHGSPVEVKIQSRSSPPTMPPLPPINPGGPRPVSFTPTALSNGINHSPPTLNGAPSPPQRFSNGPASSTSSALTNQQLPATCGARQLSKLKRFLTTLQQFGNDISPEIGEKVRTLVLALVNSTVTIEEFHCKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARAAKQTPSQYLAQHEHLLLNTSIASPADSSELLMEVHGNGKRPSPESCIIHLKSMGVASRHEYFSGTLQMPAHPVRNSTLENLWVDCSRSLRSTVLPFP Predict reactive species\nFull Name: core-binding factor, runt domain, alpha subunit 2; translocated to, 2\nCalculated Molecular Weight: 604 aa, 67 kDa\nObserved Molecular Weight: 80 kDa\nGenBank Accession Number: BC015066\nGene Symbol: CBFA2T2\nGene ID (NCBI): 9139\nRRID: AB_2070571\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43439\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869650768041,"sku":"11336-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11336-1-ap","provider":"Iright","version":"1.0","type":"link"}