{"product_id":"proteintech-11355-1-ap","title":"Proteintech, 11355-1-AP, DHX58\/LGP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DHX58\/LGP2 (11355-1-AP) by Proteintech is a Polyclonal antibody targeting DHX58\/LGP2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11355-1-AP targets DHX58\/LGP2 in WB, IHC, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, rat kidney tissue,  rat liver tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human breast cancer tissue, human nephroblastoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDHX58(Probable ATP-dependent RNA helicase DHX58) is also named as D11LGP2E, LGP2 and belongs to the RLR subfamily. DHX58, originally identified as a highly expressed gene in mammary tumors, is another cytoplasmic DEX(D\/H)-box helicase that can recognize RNA(PMID: 18411269). It acts as a positive, but not negative, regulator of RIG-I-and MDA5-dependent recognition of RNA virus infection and plays a pivotal role in antiviral responses in vivo(PMID:20080593).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, pig, monkey, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1910 Product name: Recombinant human DHX58 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 330-678 aa of BC014949 Sequence: LFDDRKNELAHLATHGPENPKLEMLEKILQRQFSSSNSPRGIIFTRTRQSAHSLLLWLQQQQGLQTVDIRAQLLIGAGNSSQSTHMTQRDQQEVIQKFQDGTLNLLVATSVAEEGLDIPHCNVVVRYGLLTNEISMVQARGRARADQSVYAFVATEGSRELKRELINEALETLMEQAVAAVQKMDQAEYQAKIRDLQQAALTKRAAQAAQRENQRQQFPVEHVQLLCINCMVAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKVFKDWKPGGVISCRNCGEVWGLQMIYKSVKLPVLKVRSMLLETPQGRIQAKKWSRVPFSVPDFDFLQHCAENLSDLSLD Predict reactive species\nFull Name: DEXH (Asp-Glu-X-His) box polypeptide 58\nCalculated Molecular Weight: 678 aa, 77 kDa\nObserved Molecular Weight: 77 kDa\nGenBank Accession Number: BC014949\nGene Symbol: DHX58\nGene ID (NCBI): 79132\nRRID: AB_2092319\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96C10\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868896645289,"sku":"11355-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11355-1-ap","provider":"Iright","version":"1.0","type":"link"}