{"product_id":"proteintech-11380-1-ap","title":"Proteintech, 11380-1-AP, DDB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DDB1 (11380-1-AP) by Proteintech is a Polyclonal antibody targeting DDB1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11380-1-AP targets DDB1 in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, mouse testis tissue,  human kidney tissue,  human placenta tissue,  human brain tissue,  rat testis tissue,  HeLa cells,  HepG2 cells,  Jurkat cells,  MCF-7 cells,  MDA-MB-231 cells,  C2C12 cells,  NIH\/3T3 cells\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human colon cancer tissue, human colon  cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDDB1, also named as XAP1, XPCe, DDBa and XPE-BF, belongs to the DDB1 family. It is required for DNA repair. DDB1 binds to DDB2 to form the UV-damaged DNA-binding protein complex (the UV-DDB complex). The UV-DDB complex may recognize UV-induced DNA damage and recruit proteins of the nucleotide excision repair pathway (the NER pathway) to initiate DNA repair. The functional specificity of the DCX E3 ubiquitin-protein ligase complex is determined by the variable substrate recognition component recruited by DDB1. This antibody is specific to DDB1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1901 Product name: Recombinant human DDB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-400 aa of BC011686 Sequence: MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHA Predict reactive species\nFull Name: damage-specific DNA binding protein 1, 127kDa\nCalculated Molecular Weight: 1140 aa, 127 kDa\nObserved Molecular Weight: 127 kDa\nGenBank Accession Number: BC011686\nGene Symbol: DDB1\nGene ID (NCBI): 1642\nRRID: AB_2088808\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16531\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868901429417,"sku":"11380-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11380-1-ap","provider":"Iright","version":"1.0","type":"link"}