{"product_id":"proteintech-11415-1-ap","title":"Proteintech, 11415-1-AP, LYPD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LYPD1 (11415-1-AP) by Proteintech is a Polyclonal antibody targeting LYPD1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11415-1-AP targets LYPD1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLY6\/PLAUR domain containing 1 (LYPD1) is a highly conserved glycosylphosphatidylinositol (GPI)-anchored protein. LYPD1 contains one cysteine-rich extracellular leukocyte antigen-6 (Ly6)\/uPAR (PLAUR) domain followed by signal sequence that triggers posttranslational GPI-anchor addition incorporating mature, LYPD1 into the plasma membrane. LYPD1 is believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. LYPD1 increases receptor desensitization in vitro and decreases affinity for ACh of alpha-4:beta-2-containing nAChRs. LYPD1 has 4 isoforms produced by alternative splicing (PMID: 33536191).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1965 Product name: Recombinant human LYPD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC017318 Sequence: MWVLGIAATFCGLFLLPGFALQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSSASALRPGLRTTILFLKLALFSAHC Predict reactive species\nFull Name: LY6\/PLAUR domain containing 1\nCalculated Molecular Weight: 141 aa, 15 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC017318\nGene Symbol: LYPD1\nGene ID (NCBI): 116372\nRRID: AB_3085372\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N2G4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887710064809,"sku":"11415-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11415-1-ap","provider":"Iright","version":"1.0","type":"link"}