{"product_id":"proteintech-11417-2-ap","title":"Proteintech, 11417-2-AP, COX7B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COX7B (11417-2-AP) by Proteintech is a Polyclonal antibody targeting COX7B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11417-2-AP targets COX7B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, MCF-7 cells,  rat brain tissue\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOX7B, also named as Cytochrome c oxidase subunit 7B, mitochondrial, is a 80 amino acid protein, which belongs to the cytochrome c oxidase VIIb family. COX7B protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COX7B plays a role in proper central nervous system development in vertebrates. COX7B as a terminal enzyme in the mitochondrial respiratory chain (oxidative phosphorylation OXPHOS), catalyzing the electron transfer from reduced cytochrome c to molecule oxygen and plays a role in eye development.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1988 Product name: Recombinant human COX7B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC018386 Sequence: MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVGRVTPKEWRNQ Predict reactive species\nFull Name: cytochrome c oxidase subunit VIIb\nCalculated Molecular Weight: 80 aa, 9 kDa\nObserved Molecular Weight: 9 kDa\nGenBank Accession Number: BC018386\nGene Symbol: COX7B\nGene ID (NCBI): 1349\nRRID: AB_2085709\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P24311\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869400977577,"sku":"11417-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11417-2-ap","provider":"Iright","version":"1.0","type":"link"}