{"product_id":"proteintech-11419-1-ap","title":"Proteintech, 11419-1-AP, HOPX Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HOPX (11419-1-AP) by Proteintech is a Polyclonal antibody targeting HOPX in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11419-1-AP targets HOPX in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, mouse small intestine tissue,  rat lung tissue\nPositive IHC detected in: human placenta tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHOPX (Homeodomain-only protein) gene has various synonyms including HOD, HOP, OB1, LAGY and NECC1. The protein encoded by this gene is an unusual homeodomain protein that lacks certain conserved residues required for DNA binding. HOPX has diverse effects on cardiac growth. Manipulation of Hopx function in murine models is associated with cardiac hypertrophy, dilation and fibrosis. HOPX protein acts as an antagonist to the serum response factor (SRF), which regulates the opposing processes of cell proliferation and differentiation. Overexpression of HOPX causes cardiac hypertrophy. HOPX protein can inhibit SRF-dependent transcriptional activation by recruiting histone deacetylase (HDAC) activity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1979 Product name: Recombinant human HOPX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-73 aa of BC014225 Sequence: MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVID Predict reactive species\nFull Name: HOP homeobox\nCalculated Molecular Weight: 73 aa, 8 kDa\nObserved Molecular Weight: 8-12 kDa\nGenBank Accession Number: BC014225\nGene Symbol: HOPX\nGene ID (NCBI): 84525\nRRID: AB_10693525\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BPY8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868844937385,"sku":"11419-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11419-1-ap","provider":"Iright","version":"1.0","type":"link"}