{"product_id":"proteintech-11422-1-ap","title":"Proteintech, 11422-1-AP, MARCKSL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MARCKSL1 (11422-1-AP) by Proteintech is a Polyclonal antibody targeting MARCKSL1 in WB, IHC, ELISA applications with reactivity to human samples\n11422-1-AP targets MARCKSL1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue\nPositive IHC detected in: human lung cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMARCKS-like protein 1 (MARCKSL1) is widely expressed in nervous tissue, it is also named MARCKS-like protein (MLP) or MARCKS-related protein (MRP) and belongs to the MARCKS family, which is a highly acidic myristoylated family of PKC substrates widely distributed in diverse cell types including macrophages. The protein has a calculated molecular weight of 20 kDa and an apparent molecular weight of 42-48 kDa due to anomalous migration on SDS gels or phosphorylation. Genetic disruption of MARCKSL1 results in neural tube closure defects, events that depend on coordinated control of actin functions, cell shape, and cell migration. MARCKSL1 are thought to regulate the actin cytoskeleton and thereby participate in major cellular responses such as phagocytosis, secretion, motility, mitogenesis, and membrane trafficking.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1967 Product name: Recombinant human MARCKSL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-195 aa of BC007904 Sequence: MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPPSQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE Predict reactive species\nFull Name: MARCKS-like 1\nCalculated Molecular Weight: 195 aa, 20 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC007904\nGene Symbol: MARCKSL1\nGene ID (NCBI): 65108\nRRID: AB_2140456\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49006\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869558329513,"sku":"11422-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11422-1-ap","provider":"Iright","version":"1.0","type":"link"}