{"product_id":"proteintech-11450-1-ap","title":"Proteintech, 11450-1-AP, Myozenin 2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Myozenin 2 (11450-1-AP) by Proteintech is a Polyclonal antibody targeting Myozenin 2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11450-1-AP targets Myozenin 2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, rat heart tissue\nPositive IHC detected in: human heart tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMYOZ2 gene encodes for the calcineurin-binding protein myozenin-2 (or Calsarcin-1) belonging to myozenin family. Defects in MYOZ2 gene are the cause of familial hypertrophic cardiomyopathy type 16 (CMH16), a hereditary heart disorder characterized by ventricular hypertrophy. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death (PMID: 17347475). Myozenins may serve as intracellular binding proteins involved in linking Z line proteins such as alpha-actinin, and gamma-filamin. Important role in the modulation of calcineurin signaling and myofibrillogenesis of myozenin-2 have been elucidated (PMID: 11114196). Proteintech's Myozenin-2 antibody 11450-1-AP was raised against full-length protein of human origin and is able to detect band of approximate 34 kDa in Western blotting.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2008 Product name: Recombinant human MYOZ2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-264 aa of BC017402 Sequence: MLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKKVSIPRDIMLEELSHLSNRGARLFKMRQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPRSPPNPDNIAPGYSGPLKEIPPEKFNTTAVPKYYQSPWEQAISNDPELLEALYPKLFKPEGKAELPDYRSFNRVATPFGGFEKASRMVKFKVPDFELLLLTDPRFMSFVNPLSGRRSFNRTPKGWISENIPIVITTEPTDDTTVPESEDL Predict reactive species\nFull Name: myozenin 2\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 30-35 kDa\nGenBank Accession Number: BC017402\nGene Symbol: Myozenin 2\nGene ID (NCBI): 51778\nRRID: AB_2146749\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NPC6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869564129449,"sku":"11450-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11450-1-ap","provider":"Iright","version":"1.0","type":"link"}