{"product_id":"proteintech-11460-1-ap","title":"Proteintech, 11460-1-AP, COX6A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COX6A1 (11460-1-AP) by Proteintech is a Polyclonal antibody targeting COX6A1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11460-1-AP targets COX6A1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, NIH\/3T3 cells,  rat liver tissue\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells, SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOX6A1(Cytochrome c oxidase subunit 6A1, mitochondrial) is also named as COX6AL and belongs to the cytochrome c oxidase subunit 6A family.This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2006 Product name: Recombinant human COX6A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC007723 Sequence: MAVVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE Predict reactive species\nFull Name: cytochrome c oxidase subunit VIa polypeptide 1\nCalculated Molecular Weight: 85 aa, 9 kDa\nObserved Molecular Weight: 9.5 kDa\nGenBank Accession Number: BC007723\nGene Symbol: COX6A1\nGene ID (NCBI): 1337\nRRID: AB_2085445\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P12074\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868901232809,"sku":"11460-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11460-1-ap","provider":"Iright","version":"1.0","type":"link"}