{"product_id":"proteintech-11465-1-ap","title":"Proteintech, 11465-1-AP, FXYD7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FXYD7 (11465-1-AP) by Proteintech is a Polyclonal antibody targeting FXYD7 in WB, ELISA applications with reactivity to human,  mouse,   rat, pig samples\n11465-1-AP targets FXYD7 in WB, ELISA applications and shows reactivity with human,  mouse,   rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue,  human brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFXYD7 (FXYD domain containing ion transport regulator 7) is a single-pass membrane protein that belongs to the FXYD family. The FXYD family, which contains seven members, are tissue specific regulators of the Na,K-ATPase. Expressed exclusively in the brain, FXYD7 is an isoform-specific Na,K-ATPase regulator which could play an important role in neuronal excitability. It has been reported that FXYD7 bears post-translationally added modifications on threonine residues and has an apparent molecular weight of 18 kDa (PMID: 12093728).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2030 Product name: Recombinant human FXYD7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC018619 Sequence: MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVKCRKADSRSESPTCKSCKSELPSSAPGGGGV Predict reactive species\nFull Name: FXYD domain containing ion transport regulator 7\nCalculated Molecular Weight: 9 kDa\nObserved Molecular Weight: 18-20 kDa\nGenBank Accession Number: BC018619\nGene Symbol: FXYD7\nGene ID (NCBI): 53822\nRRID: AB_2108627\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P58549\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887644758185,"sku":"11465-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11465-1-ap","provider":"Iright","version":"1.0","type":"link"}