{"product_id":"proteintech-11475-1-ap","title":"Proteintech, 11475-1-AP, MTAP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MTAP (11475-1-AP) by Proteintech is a Polyclonal antibody targeting MTAP in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11475-1-AP targets MTAP in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HCT 116 cells,  Raji cells,  HT-29 cells,  HeLa cells,  NIH\/3T3 cells,  C6 cells,  mouse heart tissue\nPositive IHC detected in: human colon cancer tissue, human colon tissue,  human liver cancer tissue,  mouse heart tissue,  mouse skin tissue,  rat skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMTAP is a 5-deoxy-5-methylthioadenosine (MTA) phosphorylase, converting MTA to salvageable intermediates including adenine and 5-methylthioribose-1-phosphate. MTAP is abundant in normal cells, but it is frequently found to be deleted in a variety of cancers. Its deficiency is common in cancer cell lines as well as in primary leukemia, lung cancer, melanoma, bladder cancer, gliomas and breast cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2051 Product name: Recombinant human MTAP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-154 aa of BC018625 Sequence: MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS Predict reactive species\nFull Name: methylthioadenosine phosphorylase\nCalculated Molecular Weight: 283 aa, 31 kDa\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: BC018625\nGene Symbol: MTAP\nGene ID (NCBI): 4507\nRRID: AB_2147094\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13126\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868860666025,"sku":"11475-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11475-1-ap","provider":"Iright","version":"1.0","type":"link"}