{"product_id":"proteintech-11479-1-ap","title":"Proteintech, 11479-1-AP, TIMM9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TIMM9 (11479-1-AP) by Proteintech is a Polyclonal antibody targeting TIMM9 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11479-1-AP targets TIMM9 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, mouse liver tissue,  HepG2 cells\nPositive IHC detected in: human liver tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2050 Product name: Recombinant human TIMM9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-89 aa of BC020213 Sequence: MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR Predict reactive species\nFull Name: translocase of inner mitochondrial membrane 9 homolog (yeast)\nCalculated Molecular Weight: 89 aa, 10 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC020213\nGene Symbol: TIMM9\nGene ID (NCBI): 26520\nRRID: AB_2204698\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5J7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869387378857,"sku":"11479-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11479-1-ap","provider":"Iright","version":"1.0","type":"link"}