{"product_id":"proteintech-11527-1-ap","title":"Proteintech, 11527-1-AP, UCHL5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UCHL5 (11527-1-AP) by Proteintech is a Polyclonal antibody targeting UCHL5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11527-1-AP targets UCHL5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue,  mouse brain tissue\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUCHL5 (Ubiquitin carboxyl-terminal hydrolase isozyme L5) is also named as UCH37 and belongs to the peptidase C12 family. It is functionally linked with multiple protein complexes and signal transduction pathways. UCH37's weight average molecular weight increases as a function of its concentration. By size-exclusion chromatography, the apparent molecular weight of UCH37 was 51, 56, 70, and 109 kDa at 0.15, 0.69, 2.4, and 9.5 mg\/mL, respectively. Given UCH37's monomeric molecular weight of 37 kDa and its apparent elongated shape, its tendency toward an apparent molecular weight between 40 and 50 kDa at decreasing concentrations is appropriate for UCH37 monomers (PMID:21953935).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2095 Product name: Recombinant human UCHL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-326 aa of BC025369 Sequence: MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKFEKHFEKTLLGK Predict reactive species\nFull Name: ubiquitin carboxyl-terminal hydrolase L5\nCalculated Molecular Weight: 326 aa, 37 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC025369\nGene Symbol: UCHL5\nGene ID (NCBI): 51377\nRRID: AB_2877774\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5K5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868937965737,"sku":"11527-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11527-1-ap","provider":"Iright","version":"1.0","type":"link"}