{"product_id":"proteintech-11541-1-ap","title":"Proteintech, 11541-1-AP, Ig Lambda Light Chain Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Ig Lambda Light Chain (11541-1-AP) by Proteintech is a Polyclonal antibody targeting Ig Lambda Light Chain in WB, IHC, IF-P, ELISA applications with reactivity to human samples\n11541-1-AP targets Ig Lambda Light Chain in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma tissue,  human spleen tissue\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue\nPositive FC (Intra) detected in: Ramos cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:10000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThis antibody detects the lambda light chain of human immunoglobulin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2064 Product name: Recombinant human IGL- protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-237 aa of BC020233 Sequence: MAWSPLLLTLLAHCTGSWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGFVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS Predict reactive species\nFull Name: immunoglobulin lambda locus\nCalculated Molecular Weight: 237 aa, 25 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC020233\nGene Symbol: IgG Lambda Light Chain\nGene ID (NCBI): 3535\nRRID: AB_2877775\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869696741545,"sku":"11541-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11541-1-ap","provider":"Iright","version":"1.0","type":"link"}