{"product_id":"proteintech-11545-1-ap","title":"Proteintech, 11545-1-AP, MOXD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MOXD1 (11545-1-AP) by Proteintech is a Polyclonal antibody targeting MOXD1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n11545-1-AP targets MOXD1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: rat brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMonooxygenase DBH like 1 (MOXD1) is a member of the copper monooxygenase family, including dopamine monooxygenase (dopamine β-monooxygenase, DBM) and peptidylglycine α-hydroxylating monooxygenase (PHM). MOXD1 is expressed during the development of the neural crest, and distributed along the olfactory bulb, cerebellum, brain stem, and parietal cortex with the development of nerve cells, participating in the basal plate. MOXD1 is highly expressed in GBM cells and can promote the growth of cancer cells (PMID: 35393406). In addition, MOXD1 is a gate-keeper of organ homeostasis and functions as a tumor-suppressor in neuroblastoma\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2060 Product name: Recombinant human MOXD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 262-613 aa of BC018756 Sequence: MPDAFLTCETVIFAWAIGGEGFSYPPHVGLSLGTPLDPHYVLLEVHYDNPTYEEGLIDNSGLRLFYTMDIRKYDAGVIEAGLWVSLFHTIPPGMPEFQSEGHCTLECLEEALEAEKPSGIHVFAVLLHAHLAGRGIRLRHFRKGKEMKLLAYDDDFDFNFQEFQYLKEEQTILPGDNLITECRYNTKDRAEMTWGGLSTRSEMCLSYLLYYPRINLTRCASIPDIMEQLQFIGVKEIYRPVTTWPFIIKSPKQYKNLSFMDAMNKFKWTKKEGLSFNELVLSLPVNVRCSKTDNAEWSIQGMTALPPDIERPYKAEPLVCGTSSSSSLHRDFSINLLVCLLLLSCTLSTKSL Predict reactive species\nFull Name: monooxygenase, DBH-like 1\nCalculated Molecular Weight: 69 kDa\nObserved Molecular Weight: 63-70 kDa\nGenBank Accession Number: BC018756\nGene Symbol: MOXD1\nGene ID (NCBI): 26002\nRRID: AB_10638475\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6UVY6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869560852649,"sku":"11545-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11545-1-ap","provider":"Iright","version":"1.0","type":"link"}