{"product_id":"proteintech-11570-1-ap","title":"Proteintech, 11570-1-AP, FUS\/TLS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FUS\/TLS (11570-1-AP) by Proteintech is a Polyclonal antibody targeting FUS\/TLS in WB, IHC, IF\/ICC, IF-P, IF-Fro, IP, ELISA applications with reactivity to human, mouse, rat samples\n11570-1-AP targets FUS\/TLS in WB, IHC, IF\/ICC, IF-P, IF-Fro, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  SH-SY5Y cells,  mouse brain tissue,  rat brain tissue\nPositive IP detected in: K-562 cells\nPositive IHC detected in: mouse brain tissue, human ovary tumor tissue,  rat brain tissue,  human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse colon tissue, mouse liver tissue\nPositive IF-Fro detected in: rat brain tissue\nPositive IF\/ICC detected in: HepG2 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFUS (also named TLS and POMp75) belongs to the RRM TET family. FUS may play a role in the maintenance of genomic integrity; it binds both single-stranded and double-stranded DNA and promotes ATP-independent annealing of complementary single-stranded DNAs and D-loop formation in superhelical double-stranded DNA. FUS is also an RNA-binding protein, and its links to neurodegenerative disease proffer the intriguing possibility that altered RNA metabolism or RNA processing may underlie or contribute to neuron degeneration[PMID: 22640227]. FUS may be a cause of angiomatoid fibrous histiocytoma (AFH) and is implicated in certain forms of amyotrophic lateral sclerosis (ALS) and frontotemporal dementias (FTDs) such as frontotemporal lobar dementia with ubiquitin inclusions (FTLD-U) (PMID: 22640227). This antibody is a rabbit polyclonal antibody raised against an internal region of human FUS. FUS aggregates are composed of different isoforms or fragments of various sizes, rather than only the main isoform. Bands of smaller or larger sizes (35 kDa, 75 kDa, and the gel top bands) were detected in P2h, and bands around 135 kDa and 245 kDa in S2h could be FUS oligomers (PMID: 35289333).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2150 Product name: Recombinant human FUS\/TLS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 53-400 aa of BC026062 Sequence: SSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGG Predict reactive species\nFull Name: fusion (involved in t(12;16) in malignant liposarcoma)\nCalculated Molecular Weight: 75 kDa\nObserved Molecular Weight: 68-75 kDa\nGenBank Accession Number: BC026062\nGene Symbol: FUS\/TLS\nGene ID (NCBI): 2521\nRRID: AB_2247082\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P35637\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868826685609,"sku":"11570-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11570-1-ap","provider":"Iright","version":"1.0","type":"link"}