{"product_id":"proteintech-11589-1-ap","title":"Proteintech, 11589-1-AP, BRSK2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BRSK2 (11589-1-AP) by Proteintech is a Polyclonal antibody targeting BRSK2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n11589-1-AP targets BRSK2 in WB, IP, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse testis tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBRSK2 is highly conserved from invertebrates to human, plays a key role in polarization of neurons and has been identified with different names: SAD1 is its closest homolog in C. elegans, serine\/threonine kinase SADA alfa in rat, brain-selective kinase 2 and SAD-B in mouse and hsSAD1 and SAD1B in humans(PMID:16165222) . In rat and mouse, BRSK2 is only detected in the brain and at low levels in the testis .It has some isoforms produced by alternative splicing with the molecular mass of 68-84 kDa. This protein has a conserved function throughout the evolution.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2195 Product name: Recombinant human BRSK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-170 aa of BC024291 Sequence: MSNLTPESSPELAKKSWFGNFISLEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTHDPPAAQHLSEPPPPAPGLSWGAGLKGQKVATSYESSL Predict reactive species\nFull Name: BR serine\/threonine kinase 2\nCalculated Molecular Weight: 87 kDa\nObserved Molecular Weight: 80-88 kDa\nGenBank Accession Number: BC024291\nGene Symbol: BRSK2\nGene ID (NCBI): 9024\nRRID: AB_2243660\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IWQ3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869395669161,"sku":"11589-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11589-1-ap","provider":"Iright","version":"1.0","type":"link"}