{"product_id":"proteintech-11611-2-ap","title":"Proteintech, 11611-2-AP, CDR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDR2 (11611-2-AP) by Proteintech is a Polyclonal antibody targeting CDR2 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n11611-2-AP targets CDR2 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue,  Y79 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPatients with paraneoplastic cerebellar degeneration (PCD) carry a characteristic antibody called anti-Yo. On Western blot analysis of Purkinje cells and tumor tissue from CD patient, the anti-Yo sera react with at least 2 antigens, a major species of 62 kD called CDR62 or CDR2 [PMID:18045792]. CDR2 is partly characterized, as CDR2 through its leucine zipper motif has been demonstrated to interact with c-myc, with cell cycle-related proteins and with a protein kinase, indicating that CDR2 is involved in signal transduction and gene transcription. Furthermore, CDR2 has been found to attenuate hypoxic response in renal cell carcinoma, and recent data suggest a role for CDR2 and c-myc in mitosis in cycling cells [PMID:21080165].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2183 Product name: Recombinant human CDR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 105-454 aa of BC017503 Sequence: SKASQQKILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSLSSHS Predict reactive species\nFull Name: cerebellar degeneration-related protein 2, 62kDa\nCalculated Molecular Weight: 454 aa, 52 kDa\nObserved Molecular Weight: 62 kDa\nGenBank Accession Number: BC017503\nGene Symbol: CDR2\nGene ID (NCBI): 1039\nRRID: AB_2076734\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q01850\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869654962345,"sku":"11611-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11611-2-ap","provider":"Iright","version":"1.0","type":"link"}