{"product_id":"proteintech-11613-1-ap","title":"Proteintech, 11613-1-AP, BCL11A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BCL11A (11613-1-AP) by Proteintech is a Polyclonal antibody targeting BCL11A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11613-1-AP targets BCL11A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells\nPositive IHC detected in: human tonsillitis tissue, human gliomas tissue,  mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nB-CELL CLL\/LYMPHOMA 11A(BCL11A)is a highly conserved zinc finger gene. It acts as a myeloid and B-cell proto-oncogene, and may play key roles in leukemogenesis and hematopoiesis. It is an essential factor in lymphopoiesis, and required for B-cell formation in fetal liver. May function as a modulator of the transcriptional repression activity of ARP1. It is also involved in lymphoid malignancies through translocation or amplification events. It has recently been shown that BCL11A expression is inversely correlated with γ globin expression.(PMID:21156846). This is a rabbit polyclonal antibody raised against part chain of N-terminal BCL11A of human origin. There are three isoforms of BCL11A: isoform1(773aa), isoform2(486aa) and isoform3(239aa)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2187 Product name: Recombinant human BCL11A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC021098 Sequence: MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPSPIEMKKASNPVEVGIQVTPEDDDCLSTSSRGICPKQEHIADKLLHWRGLSSPRSAHGALIPTPGMSAEYAPQGICKDEPSSYTCTTCKQPFTSAWFLLQHAQNTHGLRIYLESEHGSPLTPRVGIPSGLGAECPSQPPLHGIHIADNNPFNLLRIPGSVSREASGLAEGRFPPTPPLFSPPPRHHLDPHRIERLGAEEMALATHHPSAFDRVLRLNPMAMEPPAMDFSRRLRELAGNTSSPPLSPGRPSPMQRLLQPFQPGSK Predict reactive species\nFull Name: B-cell CLL\/lymphoma 11A (zinc finger protein)\nCalculated Molecular Weight: 835 aa, 91 kDa\nGenBank Accession Number: BC021098\nGene Symbol: BCL11A\nGene ID (NCBI): 53335\nRRID: AB_2259028\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H165\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885203116201,"sku":"11613-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11613-1-ap","provider":"Iright","version":"1.0","type":"link"}