{"product_id":"proteintech-11622-1-ap","title":"Proteintech, 11622-1-AP, DOCK8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DOCK8 (11622-1-AP) by Proteintech is a Polyclonal antibody targeting DOCK8 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11622-1-AP targets DOCK8 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, rat lung tissue,  THP-1 cells\nPositive IHC detected in: rat lung tissue, human heart tissue,  mouse kidney tissue,  mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBackgroundDedicator of Cytokinesis 8 (DOCK8) is a protein that regulates the actin cytoskeleton, with particular importance in immune cells and a key role in innate and adaptive immune responses.What is the molecular weight of DOCK8?231 kDa. DOCK8 is a protein composed of 2031 amino acids and is a guanine nucleotide exchange factor (GEF).What is the function of DOCK8?DOCK8 is a member of the DOCK family of proteins, which have a unique DRH2 domain enabling them to act as GEFs and so controlling a range of cellular processes in various signaling pathways (PMID: 12432077). The specific target of DOCK8 is Cell division control protein 42 homolog (Cdc42), a small GTPase that is involved in regulation of the cell cycle and forms a complex. DOCK8 also acts as a scaffold molecule in this complex that initiates actin polymerization via the Wiskott-Aldrich Syndrome protein (WASp) (PubMed: 28028151, PubMed: 22461490).What diseases are associated with DOCK8?The role of DOCK8 in immunity was first identified with the study of DOCK8-deficient patients who presented with combined immunodeficiency (PMID: 19776401; PMID: 20004785). The subsequent study of DOCK8 in immune cells such as T cells, natural killer (NK) cells, and B cells has revealed how it regulates their normal function. This includes the regulation of immune synapse formation, immune cell trafficking, regulation of dendritic cell polarization, and cytokine production (PMID: 28366940).DOCK8 deficiency is caused by a number of different mutations in the gene. It leads to the autosomal recessive form of the immunodeficiency disease Hyper-IgE syndrome, or Job's syndrome. The symptoms of DOCK8 deficiency include eczema, high levels of serum IgE, hypereosinophilia, and recurrent respiratory and skin infections as a result of impaired immune cell function.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2040 Product name: Recombinant human DOCK8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 257-606 aa of BC019102 Sequence: EVYKLVIPILEAHREFRKLTLTHSKLQRAFDSIVNKDHKRMFGTYFRVGFFGSKFGDLDEQEFVYKEPAITKLPEISHRLEAFYGQCFGAEFVEVIKDSTPVDKTKLDPNKAYIQITFVEPYFDEYEMKDRVTYFEKNFNLRRFMYTTPFTLEGRPRGELHEQYRRNTVLTTMHAFPYIKTRISVIQKEEFVLTPIEVAIEDMKKKTLQLAVAINQEPPDAKMLQMVLQGSVGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNKRLITADQREYQQELKKNYNKLKENLRPMIERKIPELYKPIFRVESQKRDSFHRSSFRKCETQLSQGS Predict reactive species\nFull Name: dedicator of cytokinesis 8\nCalculated Molecular Weight: 2031 aa, 231 kDa\nObserved Molecular Weight: 230-239 kDa\nGenBank Accession Number: BC019102\nGene Symbol: DOCK8\nGene ID (NCBI): 81704\nRRID: AB_10216360\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NF50\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868940488873,"sku":"11622-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11622-1-ap","provider":"Iright","version":"1.0","type":"link"}