{"product_id":"proteintech-11649-2-ap","title":"Proteintech, 11649-2-AP, EIF1AX Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EIF1AX (11649-2-AP) by Proteintech is a Polyclonal antibody targeting EIF1AX in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11649-2-AP targets EIF1AX in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, HeLa cells,  HEK-293T cells,  Jurkat cells\nPositive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEukaryotic translation initiation factor 1A, X-chromosome(EIF1AX), designated as to distinguish from the Y-linked homolog, has an unblocked N-terminal proline, which was consistent with the general pattern of eukaryotic protein. It's may be required for maximal rate of protein biosynthesis. Like EIF4C, it enhances ribosome dissociation into subunits and stabilizeds the binding of the initiator Met-tRNA(l) to 40S ribosomal subunits.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2248 Product name: Recombinant human EIF1AX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC000793 Sequence: MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI Predict reactive species\nFull Name: eukaryotic translation initiation factor 1A, X-linked\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC000793\nGene Symbol: EIF1AX\nGene ID (NCBI): 1964\nRRID: AB_2097803\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P47813\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869534179497,"sku":"11649-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11649-2-ap","provider":"Iright","version":"1.0","type":"link"}