{"product_id":"proteintech-11650-2-ap","title":"Proteintech, 11650-2-AP, CBX3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CBX3 (11650-2-AP) by Proteintech is a Polyclonal antibody targeting CBX3 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11650-2-AP targets CBX3 in WB, IHC, IF\/ICC, IP, CoIP, chIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, mouse spleen tissue,  RAW 264.7 cells,  rat spleen tissue\nPositive IP detected in: mouse spleen tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe family of Heterochromatin protein 1 (HP1) proteins is a family of highly conserved heterochromatin-associated non-histone chromosomal proteins , which has important functions in nucleus. These functions include gene activation or repression, regulation of binding of cohesion complexes to centromere, sequestration of genes to nuclear periphery, and heterochromatin formation and propagation. Much evidence shows that HP1 proteins interact with numerous proteins including methylated histones, histone methyltransferases and so on. CBX3 is one of the paralogues of HP1 proteins\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2251 Product name: Recombinant human CBX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-183 aa of BC000954 Sequence: MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ Predict reactive species\nFull Name: chromobox homolog 3 (HP1 gamma homolog, Drosophila)\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC000954\nGene Symbol: CBX3\nGene ID (NCBI): 11335\nRRID: AB_2071136\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13185\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868857520297,"sku":"11650-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11650-2-ap","provider":"Iright","version":"1.0","type":"link"}