{"product_id":"proteintech-11653-1-ap","title":"Proteintech, 11653-1-AP, AP4M1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AP4M1 (11653-1-AP) by Proteintech is a Polyclonal antibody targeting AP4M1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11653-1-AP targets AP4M1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, HeLa cells,  mouse lung tissue,  A431 cells\nPositive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAdaptor protein (AP) complex is a component of intracellular protein transport. The AP4 complex is involved in sorting transmembrane cargo proteins into transport vesicles for trans-Golgi network export. AP4M1 is a member of the AP4 complex, which also includes AP4B1, AP4E1, and AP4S1. Loss-of-function variants in any of these four members can lead to AP-4-associated hereditary spastic paraplegia (HSP), a neurodegenerative disorder (PMID: 30543385). This antibody recognizes AP4M1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2222 Product name: Recombinant human AP4M1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 203-453 aa of BC018705 Sequence: GSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFESHRILRLQPPQGELTVMRYQLSDDLPSPLPFRLFPSVQWDRGSGRLQVYLKLRCDLLSKSQALNVRLHLPLPRGVVSLSQELSSPEQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLSTSASPLGLGPASLSFELPRHTCSGLQVRFLRLAFRPCGNANPHKWVRHLSHSDAYVIRI Predict reactive species\nFull Name: adaptor-related protein complex 4, mu 1 subunit\nCalculated Molecular Weight: 453 aa, 50 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC018705\nGene Symbol: AP4M1\nGene ID (NCBI): 9179\nRRID: AB_2227267\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00189\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869514879145,"sku":"11653-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11653-1-ap","provider":"Iright","version":"1.0","type":"link"}