{"product_id":"proteintech-11677-1-ap","title":"Proteintech, 11677-1-AP, UBE2D1\/2\/3\/4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UBE2D1\/2\/3\/4 (11677-1-AP) by Proteintech is a Polyclonal antibody targeting UBE2D1\/2\/3\/4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11677-1-AP targets UBE2D1\/2\/3\/4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse brain tissue,  Hela cells,  Jurkat cells,  rat brain tissue,  mouse kidney tissue,  rat kidney tissue\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUbiquitination is a post-translational modification pathway or is part of the specific protein-degradation pathway by the 26S proteasome. Ubiquitination of a target protein involves multistep enzymatic reaction catalyzed by a cascade of enzymes including Ub-activating enzymes (E1s), Ub-conjugating enzymes (E2s) and Ub ligases (E3s) (PMID: 23542885). UBE2D family, which has 4 members named as UBE2D1\/2\/3\/4, is an E2 ubiquitin-conjugating enzyme family in the ubiquitin-proteasome system. This antibody can recognize all the four members of UBE2D due to the high homology.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, hamster\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2278 Product name: Recombinant human UBE2D3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC003395 Sequence: MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM Predict reactive species\nFull Name: ubiquitin-conjugating enzyme E2D 3 (UBC4\/5 homolog, yeast)\nCalculated Molecular Weight: 17 kDa\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: BC003395\nGene Symbol: UBE2D3\nGene ID (NCBI): 7323\nRRID: AB_2256691\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P61077\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868922040489,"sku":"11677-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11677-1-ap","provider":"Iright","version":"1.0","type":"link"}