{"product_id":"proteintech-11686-1-ap","title":"Proteintech, 11686-1-AP, HMGN4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HMGN4 (11686-1-AP) by Proteintech is a Polyclonal antibody targeting HMGN4 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n11686-1-AP targets HMGN4 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHMGN4, also named as High mobility group nucleosome-binding domain-containing protein 4, is a 90 amino acid protein, which belongs to the HMGN family. HMGN4 as a DNA-binding protein localizes in the nucleus. The calculated molecular weight of HMGN4 is 10 kDa, but the modified HMGN4 protein is about 15 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2298 Product name: Recombinant human HMGN4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC001282 Sequence: MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK Predict reactive species\nFull Name: high mobility group nucleosomal binding domain 4\nCalculated Molecular Weight: 90 aa, 10 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC001282\nGene Symbol: HMGN4\nGene ID (NCBI): 10473\nRRID: AB_2118489\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00479\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887669399721,"sku":"11686-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11686-1-ap","provider":"Iright","version":"1.0","type":"link"}