{"product_id":"proteintech-11687-1-ap","title":"Proteintech, 11687-1-AP, DYNLT3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DYNLT3 (11687-1-AP) by Proteintech is a Polyclonal antibody targeting DYNLT3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n11687-1-AP targets DYNLT3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U-937 cells, HeLa cells\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDynein light chain Tctex-type 3 (DYNLT3) is a member of the cytoplasmic dynamic protein light chain Tctex family. DYNLT3 mainly plays a regulatory role in mitosis and meiosis, as well as chromosome binding. DYNLT3 is expressed in all cells and tissues. The calculated molecular weight of DYNLT3 is 13 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2299 Product name: Recombinant human DYNLT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC000968 Sequence: MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL Predict reactive species\nFull Name: dynein, light chain, Tctex-type 3\nCalculated Molecular Weight: 116 aa, 13 kDa\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: BC000968\nGene Symbol: DYNLT3\nGene ID (NCBI): 6990\nRRID: AB_2093777\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P51808\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887381598377,"sku":"11687-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11687-1-ap","provider":"Iright","version":"1.0","type":"link"}