{"product_id":"proteintech-11692-1-ap","title":"Proteintech, 11692-1-AP, TAX1BP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TAX1BP3 (11692-1-AP) by Proteintech is a Polyclonal antibody targeting TAX1BP3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11692-1-AP targets TAX1BP3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, NIH\/3T3 cells,  mouse kidney tissue,  rat kidney tissue\nPositive IHC detected in: human colon tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTax-interacting protein 1 (TIP-1, also known as Tax1bp3 or glutaminase-interacting protein, GIP) is unique in its simple structure, a single PDZ domain is the only functional and structural unit identified so far in this small PDZ protein (124 amino acids in human and mouse). High level of TIP-1 expression was detected in human invasive breast cancer cells and that is important for tumor cell adhesion, migration and pulmonary metastasis. However, the precise biological effects of TIP-1 and its functional mechanisms have largely remained elusive. Mutation of TAX1BP3 can cause Dilated Cardiomyopathy with Septo-Optic Dysplasia (PMID: 25645515).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2306 Product name: Recombinant human TAX1BP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-124 aa of BC023980 Sequence: MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS Predict reactive species\nFull Name: Tax1 (human T-cell leukemia virus type I) binding protein 3\nCalculated Molecular Weight: 124 aa, 14 kDa\nObserved Molecular Weight: 15-17 kDa\nGenBank Accession Number: BC023980\nGene Symbol: TAX1BP3\nGene ID (NCBI): 30851\nRRID: AB_11182823\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14907\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869775515817,"sku":"11692-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11692-1-ap","provider":"Iright","version":"1.0","type":"link"}