{"product_id":"proteintech-11694-1-ap","title":"Proteintech, 11694-1-AP, ARL5B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARL5B (11694-1-AP) by Proteintech is a Polyclonal antibody targeting ARL5B in WB, IHC, ELISA applications with reactivity to human samples\n11694-1-AP targets ARL5B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, HepG2 cells,  HeLa cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nARL5B, also known as ADP ribosylation factor-like GTPase 5B, is a small G protein that is localized to the trans-Golgi network (TGN) in mammalian cells. It plays a significant role in the regulation of retrograde membrane transport from endosomes back to the TGN. This function is particularly important for the maintenance of cellular membrane traffic and the organization of the Golgi apparatus.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2309 Product name: Recombinant human ARL5B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-179 aa of BC024163 Sequence: MGLIFAKLWSLFCNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISKYLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRIGVR Predict reactive species\nFull Name: ADP-ribosylation factor-like 5B\nCalculated Molecular Weight: 179 aa, 20 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC024163\nGene Symbol: ARL5B\nGene ID (NCBI): 221079\nRRID: AB_2058835\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96KC2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869393211561,"sku":"11694-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11694-1-ap","provider":"Iright","version":"1.0","type":"link"}