{"product_id":"proteintech-11717-1-ap","title":"Proteintech, 11717-1-AP, RHOD Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RHOD (11717-1-AP) by Proteintech is a Polyclonal antibody targeting RHOD in IF, IHC, ELISA applications with reactivity to human samples\n11717-1-AP targets RHOD in IF, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human lung cancer tissue,  human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF detected in: Human Retina Whole Mount\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF): IF : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRhoD is a member of the Rho family of small GTPases, and it has been implicated in integrating actin reorganization and endosome motility. RhoD localizes to early endosomes and recycling endosomes, which indicates its important role in the regulation of endosome trafficking. It is involved in reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2291 Product name: Recombinant human RHOD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-210 aa of BC001338 Sequence: MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQVKGKPVHLHIWDTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLRKDKSLVNKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRGRNFWRRITQGFCVVT Predict reactive species\nFull Name: ras homolog gene family, member D\nCalculated Molecular Weight: 210 aa, 23 kDa\nGenBank Accession Number: BC001338\nGene Symbol: RHOD\nGene ID (NCBI): 29984\nRRID: AB_2877789\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00212\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887784546473,"sku":"11717-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11717-1-ap","provider":"Iright","version":"1.0","type":"link"}