{"product_id":"proteintech-11728-1-ap","title":"Proteintech, 11728-1-AP, CHCHD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHCHD1 (11728-1-AP) by Proteintech is a Polyclonal antibody targeting CHCHD1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n11728-1-AP targets CHCHD1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\nPositive FC (Intra) detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2325 Product name: Recombinant human CHCHD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC020852 Sequence: MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQNEFRDDACRKEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYLS Predict reactive species\nFull Name: coiled-coil-helix-coiled-coil-helix domain containing 1\nCalculated Molecular Weight: 13 kDa\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: BC020852\nGene Symbol: CHCHD1\nGene ID (NCBI): 118487\nRRID: AB_2079769\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96BP2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869524480169,"sku":"11728-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11728-1-ap","provider":"Iright","version":"1.0","type":"link"}