{"product_id":"proteintech-11734-1-ap","title":"Proteintech, 11734-1-AP, EID1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EID1 (11734-1-AP) by Proteintech is a Polyclonal antibody targeting EID1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n11734-1-AP targets EID1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-1080 cells, U-937 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEID1(EP300 interacting inhibitor of differentiation 1) is a member of the EID protein family, which regulates differentiation, transcription and acetyltransferase activity. EID1 function was originally identified as a transcriptional repressor which regulates cell cycle and differentiation, and leads to genome inactivation and instability by interacting with E3 ubiquitin ligase MDM2. EID1 is mainly located in the cytoplasm. It was translocated into the nuclei under stressed or pathological conditions such as AD patients and APP Tg mice brains.(PMID: 22186421, PMID: 31381951,PMID: 30926163).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2336 Product name: Recombinant human EID1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-187 aa of BC024151 Sequence: MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE Predict reactive species\nFull Name: EP300 interacting inhibitor of differentiation 1\nCalculated Molecular Weight: 187 aa, 21 kDa\nObserved Molecular Weight: 20-30 kDa\nGenBank Accession Number: BC024151\nGene Symbol: EID1\nGene ID (NCBI): 23741\nRRID: AB_10640804\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y6B2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869404352681,"sku":"11734-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11734-1-ap","provider":"Iright","version":"1.0","type":"link"}