{"product_id":"proteintech-11743-1-ap","title":"Proteintech, 11743-1-AP, PKIA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PKIA (11743-1-AP) by Proteintech is a Polyclonal antibody targeting PKIA in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11743-1-AP targets PKIA in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse embryo tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\ncAMP-dependent protein kinase inhibitor alpha (PKIA) is also named as PRKACN1, and belongs to the PKI family. Among them, PKIA, a member of protein kinase A (PKA) inhibitor family, was found to be most significantly and highly expressed in susceptible animals (PMID:24910983). Decreased PKIA signaling would directly impact PKA activation, potentially inducing DRP1 phosphorylation and increasing ER Ca2+ stores (PMID:32152556). miR-129-5p activated PKA to regulate the phosphorylation of beta-catenin and cAMP-response element binding protein (CREB) by inhibiting PKIA (PMID:36222334).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2338 Product name: Recombinant human PKIA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-76 aa of BC022265 Sequence: MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSSTEQSGEAQGEAAKSES Predict reactive species\nFull Name: protein kinase (cAMP-dependent, catalytic) inhibitor alpha\nCalculated Molecular Weight: 76 aa, 8 kDa\nGenBank Accession Number: BC022265\nGene Symbol: PKIA\nGene ID (NCBI): 5569\nRRID: AB_3085380\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P61925\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887763345577,"sku":"11743-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11743-1-ap","provider":"Iright","version":"1.0","type":"link"}