{"product_id":"proteintech-11746-1-ap","title":"Proteintech, 11746-1-AP, HBP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HBP1 (11746-1-AP) by Proteintech is a Polyclonal antibody targeting HBP1 in WB, IP, ELISA applications with reactivity to human, mouse samples\n11746-1-AP targets HBP1 in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue, SGC-7901 cells\nPositive IP detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHMG-box protein 1 (HBP1) is a transcriptional repressor, and has a role in cell cycle progression and tumor suppression. Also it's a repressor of the cyclin D1 gene and inhibits the Wnt signaling pathway. Interaction with RB1 enhances it's binding to the H1F0 promoter . Disrupts the interaction between DNA and TCF4. This is a rabbit polyclonal antibody raised against part of C-terminus of HBP1 of human origin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2342 Product name: Recombinant human HBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 215-514 aa of BC022329 Sequence: FLKGTRLCFHKGSNKEWQDVEDFARAEGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINFDDPGVFDTFKSYDFTPMDSSAVYVLSSMARQRRASLSCGGPGGQDFARSGFSKNCGSPGSSQLSSNSLYAKAVKNHSSGTVSATSPNKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEERRMYTLEAKALAEEQKRLNPDCWKRKRTNSGSQQH Predict reactive species\nFull Name: HMG-box transcription factor 1\nCalculated Molecular Weight: 514 aa, 58 kDa\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: BC022329\nGene Symbol: HBP1\nGene ID (NCBI): 26959\nRRID: AB_2247970\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60381\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868902215849,"sku":"11746-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11746-1-ap","provider":"Iright","version":"1.0","type":"link"}