{"product_id":"proteintech-11758-1-ap","title":"Proteintech, 11758-1-AP, HFE2\/Hemojuvelin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HFE2\/Hemojuvelin (11758-1-AP) by Proteintech is a Polyclonal antibody targeting HFE2\/Hemojuvelin in WB, ELISA applications with reactivity to human, mouse, rat samples\n11758-1-AP targets HFE2\/Hemojuvelin in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse liver tissue,  rat heart tissue,  rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHFE2, also known as Hemojuvelin (HJV), is a GPI-anchored protein that binds to new proteins and bone morphogenetic proteins (BMP2 and BMP4) and can be released from the cell membrane. HFE2 plays a key role in the regulation of hepcidin, which regulates the absorption and recycling of iron.(PMID: 17331953; PMID: 17938254)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2354 Product name: Recombinant human HFE2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 227-426 aa of BC017926 Sequence: MQECIDQKVYQAEVDNLPVAFEDGSINGGDRPGGSSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPSDAGVPLSSATLLAPLLSGLFVLWLCIQ Predict reactive species\nFull Name: hemochromatosis type 2 (juvenile)\nCalculated Molecular Weight: 426 aa, 45 kDa\nObserved Molecular Weight: 23 kDa, 38 kDa, 45-50 kDa\nGenBank Accession Number: BC017926\nGene Symbol: HFE2\nGene ID (NCBI): 148738\nRRID: AB_2877792\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6ZVN8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869692776617,"sku":"11758-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11758-1-ap","provider":"Iright","version":"1.0","type":"link"}