{"product_id":"proteintech-11760-1-ap","title":"Proteintech, 11760-1-AP, HNRNPC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HNRNPC (11760-1-AP) by Proteintech is a Polyclonal antibody targeting HNRNPC in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n11760-1-AP targets HNRNPC in WB, IHC, IF\/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human brain tissue,  K-562 cells,  HepG2 cells,  MCF-7 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse colon tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHNRNPC, also named as Heterogeneous nuclear ribonucleoproteins C1\/C2, is a 306 amino acid protein, which contains 1 RRM (RNA recognition motif) domain and belongs to the RRM HNRPC family. HNRNPC localizes in the nucleus. It binds pre-mRNA and nucleates the assembly of 40S hnRNP particles. HNRNPC may play a role in the early steps of spliceosome assembly and pre-mRNA splicing. HNRNPC can act as a tetramer and is involved in the assembly of 40S hnRNP particles and plays a role with CSDE1 in internal initiation of translation during mitosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2356 Product name: Recombinant human HNRNPC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-293 aa of BC003394 Sequence: MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS Predict reactive species\nFull Name: heterogeneous nuclear ribonucleoprotein C (C1\/C2)\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 32 kDa, 36-40 kDa\nGenBank Accession Number: BC003394\nGene Symbol: HNRNPC\nGene ID (NCBI): 3183\nRRID: AB_2117500\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P07910\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868842447017,"sku":"11760-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11760-1-ap","provider":"Iright","version":"1.0","type":"link"}