{"product_id":"proteintech-11763-1-ap","title":"Proteintech, 11763-1-AP, ENOPH1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ENOPH1 (11763-1-AP) by Proteintech is a Polyclonal antibody targeting ENOPH1 in WB, ELISA applications with reactivity to human samples\n11763-1-AP targets ENOPH1 in WB, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, HL-60 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nENOPH1, also named as MASA and MSTP145, belongs to the HAD-like hydrolase superfamily and MasA\/MtnC family. ENOPH1 is a newly identified enzyme involved in L-methionine biosynthesis, which is associated with anxiety and depression. Studies have shown that ENOPH1 plays a crucial role in promoting the proliferation and migration of glioma cells (PMID: 32654229). ENOPH1 has 2 isoforms with the molecular mass of 13 and 29 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2360 Product name: Recombinant human ENOPH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC001317 Sequence: MKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST Predict reactive species\nFull Name: enolase-phosphatase 1\nCalculated Molecular Weight: 13 kDa \/ 29 kDa\nObserved Molecular Weight: 29-35 kDa\nGenBank Accession Number: BC001317\nGene Symbol: ENOPH1\nGene ID (NCBI): 58478\nRRID: AB_10794441\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UHY7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869534867625,"sku":"11763-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11763-1-ap","provider":"Iright","version":"1.0","type":"link"}