{"product_id":"proteintech-11769-1-ap","title":"Proteintech, 11769-1-AP, Septin 8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Septin 8 (11769-1-AP) by Proteintech is a Polyclonal antibody targeting Septin 8 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11769-1-AP targets Septin 8 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse testis tissue,  K-562 cells,  mouse brain tissue,  rat brain tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human gliomas tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: hTERT-RPE1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSeptin 8, also named as KIAA0202, is a member of the highly conserved septin family. Septins are 40-60kD GTPases that assemble as filamentous scaffolds. They are involved in the organization of submembranous structures, in neuronal polarity, and in vesicle trafficking. It may play a role in platelet secretion. Septin 8 is about 50-56 kDa in WB detection.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2357 Product name: Recombinant human SEPT8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-256 aa of BC001329 Sequence: MKKLDSKVNIIPIIAKADTISKSELHKFKIKIMGELVSNGVQIYQFPTDDEAVAEINAVMNAHLPFAVVGSTEEVKVGNKLVRARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHSRHYELYRRCKLEEMGFQDSDGDSQPFSLQETYEAKRKEFLSELQRKEEEMRQMFVNKVKETELELKEKERELHEKFEHLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEALQSQALHATSQQPLRKDKDK Predict reactive species\nFull Name: septin 8\nCalculated Molecular Weight: 55.6 kDa\nObserved Molecular Weight: 50-56 kDa\nGenBank Accession Number: BC001329\nGene Symbol: Septin 8\nGene ID (NCBI): 23176\nRRID: AB_2185006\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92599\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868920959145,"sku":"11769-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11769-1-ap","provider":"Iright","version":"1.0","type":"link"}