{"product_id":"proteintech-11770-1-ap","title":"Proteintech, 11770-1-AP, ITLN1\/2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ITLN1\/2 (11770-1-AP) by Proteintech is a Polyclonal antibody targeting ITLN1\/2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11770-1-AP targets ITLN1\/2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue\nPositive IP detected in: mouse appendix tissue\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nITLN1, also named as Intelectin 1, has no effect on basal glucose uptake but enhances insulin-stimulated glucose uptake in adipocytes. ITLN1 is a glycoprotein made up of three 40 kDa subunits cross-linked by disulfide bonds making up a 120-kDa homo-trimer of 295 amino acids and N-linked oligosaccharides (PMID: 17621593). It may play a role in the defense system against microorganisms. Human intelectin-1 is expressed in intestinal goblet cells, and is present at about 200 ng\/mL in serum. Intelectin-1 was also shown to be expressed in human endothelial cells and adipocytes of human abdominal adipose tissue. (PMID: 22768319,PMID: 28640441)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2424 Product name: Recombinant human ITLN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-313 aa of BC020664 Sequence: MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYSSSREITEAAVLLFYR Predict reactive species\nFull Name: intelectin 1 (galactofuranose binding)\nCalculated Molecular Weight: 313 aa, 35 kDa\nObserved Molecular Weight: 35-40 kDa\nGenBank Accession Number: BC020664\nGene Symbol: ITLN1\nGene ID (NCBI): 55600\nRRID: AB_2129677\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WWA0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868879278249,"sku":"11770-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11770-1-ap","provider":"Iright","version":"1.0","type":"link"}