{"product_id":"proteintech-11778-1-ap","title":"Proteintech, 11778-1-AP, VWF, VWFpp Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VWF, VWFpp (11778-1-AP) by Proteintech is a Polyclonal antibody targeting VWF, VWFpp in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n11778-1-AP targets VWF, VWFpp in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, Jurkat cells,  human placenta tissue,  mouse spleen tissue,  rat spleen tissue\nPositive IP detected in: mouse spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVon Willebrand factor (vWF) is a large multimeric glycoprotein that is crucial to the hemostasis process. It supports platelet adhesion and carries factor VIII (FVIII). Deficiency of vWF results in von Willebrand disease (vWD), a common inherited bleeding disorder. The pre-pro-vWF is comprised of 2,813 amino acids (aa) which encompass a 22-aa signal peptide, a 741-aa large propeptide (vWF propeptide, vWFpp, also called von Willebrand antigen 2) and 2,050 aa making up the mature vWF. The von Willebrand antigen 2 is required for multimerization of vWF and for its targeting to storage granules. This antibody raised against the N-terminal region of pre-pro-vWF recognizes von Willebrand antigen 2 (75-100 kDa) and pro-vWF (309-320 kDa). (PMID: 9759493; 12067899; 22452980; 8874191)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2386 Product name: Recombinant human VWF, VWFpp protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-273 aa of . Sequence: MGAQDEEEGIQDLDGLLVFDKIVEVTLLNLPWYNEETEGQRGEMTAPKSPRAKIRGTLCAEGTRGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYLLAGGCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTLTSDPYDFANSWALSSGEQWCERASPPSSSCNISSGEMQKVGVDWPGCTWMVCDFWI Predict reactive species\nFull Name: von Willebrand factor\nCalculated Molecular Weight: 309 kDa\nObserved Molecular Weight: 309-320 kDa, 75-100 kDa\nGenBank Accession Number: .\nGene Symbol: VWF\nGene ID (NCBI): 7450\nRRID: AB_10642840\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P04275\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868827570345,"sku":"11778-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11778-1-ap","provider":"Iright","version":"1.0","type":"link"}