{"product_id":"proteintech-11783-1-ap","title":"Proteintech, 11783-1-AP, PTPN22 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PTPN22 (11783-1-AP) by Proteintech is a Polyclonal antibody targeting PTPN22 in WB, IHC, IP, ELISA applications with reactivity to human samples\n11783-1-AP targets PTPN22 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, Raji cells,  Jurkat cells\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPTPN22(Tyrosine-protein phosphatase non-receptor type 22) is also named as LyP,PEP,PTPN8.It belongs to the protein-tyrosine phosphatase family and non-receptor class 4 subfamily.It acts as negative regulator of T-cell receptor (TCR) signaling.Defects in PTPN22 are a cause of susceptibility to systemic lupus erythematosus (SLE). It has some isoforms produced by alternative splicing with calculated molecular mass of 79-92 kDa, and apparent molecular mass of 100-110 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2397 Product name: Recombinant human PTPN22 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-179 aa of BC017785 Sequence: MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKEAEKRKSDYIIRTLKVKFNSVSVILAHQTSLQNLFSQITPAHF Predict reactive species\nFull Name: protein tyrosine phosphatase, non-receptor type 22 (lymphoid)\nCalculated Molecular Weight: 82 kDa, 92 kDa\nObserved Molecular Weight: 100-110 kDa\nGenBank Accession Number: BC017785\nGene Symbol: PTPN22\nGene ID (NCBI): 26191\nRRID: AB_2173378\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2R2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869008023721,"sku":"11783-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11783-1-ap","provider":"Iright","version":"1.0","type":"link"}