{"product_id":"proteintech-11784-1-ap","title":"Proteintech, 11784-1-AP, LY96\/MD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LY96\/MD2 (11784-1-AP) by Proteintech is a Polyclonal antibody targeting LY96\/MD2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11784-1-AP targets LY96\/MD2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLY96, also named as  ESOP1 or MD 2, is a small secreted glycoprotein that can bind to both the hydrophobic portion of LPS and to the extracellular domain of TLR4. The interaction between MD-2 and LPS bridges the two TLR4 molecules and induces the dimerization of LPS-MD-2-TLR4, which forms the structural basis for biological functions of TLR4\/MD-2 complex. Due to its essential role in mediating the interaction between LPS and TLR4, MD-2 has been extensively explored as a therapeutic target for treatment of inflammatory disorders.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2447 Product name: Recombinant human LY96 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-160 aa of BC020690 Sequence: MLPFLFFSTLFSSIFTEAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN Predict reactive species\nFull Name: lymphocyte antigen 96\nCalculated Molecular Weight: 160 aa, 18 kDa\nObserved Molecular Weight: 20-26 kDa\nGenBank Accession Number: BC020690\nGene Symbol: MD2\nGene ID (NCBI): 23643\nRRID: AB_2138089\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y6Y9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868893958313,"sku":"11784-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11784-1-ap","provider":"Iright","version":"1.0","type":"link"}