{"product_id":"proteintech-11795-1-ap","title":"Proteintech, 11795-1-AP, TPD52L2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TPD52L2 (11795-1-AP) by Proteintech is a Polyclonal antibody targeting TPD52L2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11795-1-AP targets TPD52L2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse brain tissue,  rat brain tissue,  MCF-7 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTumor protein D52-like proteins (TPD52) are small coiled-coil motif bearing proteins that were first identified in breast carcinoma. Three human TPD52 members had been identified, named hD52 (TPD52), hD53 (TPD52L1), and hD54 (TPD52L2). The most important characteristic of the protein family is a highly conserved coiled-coil motif that is required for homo- and heteromeric interaction with other TPD52-like proteins. TPD52 and related proteins have been implicated in cell proliferation, apoptosis, and vesicle trafficking. TPD52L2 has five isoforms produced by alternative splicing, and its multiple sites have been identified to be phosphorylated. Interaction of TPD52L2 with MAL2, a novel member of the MAL proteolipid family, may be required for the role of TPD52L2 in vesicle transport.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2364 Product name: Recombinant human TPD52L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC006804 Sequence: MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLS Predict reactive species\nFull Name: tumor protein D52-like 2\nCalculated Molecular Weight: 206 aa, 22 kDa\nObserved Molecular Weight: 25-30 kDa\nGenBank Accession Number: BC006804\nGene Symbol: TPD52L2\nGene ID (NCBI): 7165\nRRID: AB_2207431\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43399\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868961591465,"sku":"11795-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11795-1-ap","provider":"Iright","version":"1.0","type":"link"}