{"product_id":"proteintech-11803-1-ap","title":"Proteintech, 11803-1-AP, S100P Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe S100P (11803-1-AP) by Proteintech is a Polyclonal antibody targeting S100P in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n11803-1-AP targets S100P in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HuH-7 cells\nPositive IHC detected in: human pancreas cancer tissue, human bowen disease tissue,  human colon cancer tissue,  human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nS100P protein is a relatively small (95 amino acid) isoform of the S100 protein family that was first isolated from human placenta. Overexpression of S100P has been detected in several cancers such as breast, colon, prostate, pancreatic and lung carcinomas, and the protein has been functionally implicated in carcinogenic processes. S100P protein is widely expressed in both normal and neoplastic tissues. It clearly shows ectopic expression in some cancers. Based on the high expression in certain tumors, S100P could represent a potential target for novel diagnostic and therapeutic applications.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2379 Product name: Recombinant human S100P protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC006819 Sequence: MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK Predict reactive species\nFull Name: S100 calcium binding protein P\nCalculated Molecular Weight: 95 aa, 11 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC006819\nGene Symbol: S100P\nGene ID (NCBI): 6286\nRRID: AB_2184577\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P25815\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868944978089,"sku":"11803-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11803-1-ap","provider":"Iright","version":"1.0","type":"link"}