{"product_id":"proteintech-11811-1-ap","title":"Proteintech, 11811-1-AP, SIRP beta 1\/CD172b Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SIRP beta 1\/CD172b (11811-1-AP) by Proteintech is a Polyclonal antibody targeting SIRP beta 1\/CD172b in WB, ELISA applications with reactivity to human samples\n11811-1-AP targets SIRP beta 1\/CD172b in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U-937 cells, A375 cells,  PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSIRP Beta 1 is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are cell surface signaling receptors differentially expressed in leukocytes and the central nervous system. SIRP Beta 1 interacts with TYROBP\/DAP12, a protein bearing immunoreceptor tyrosine-based activation motifs. SIRP Beta 1 also participates in the recruitment of tyrosine kinase SYK.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2478 Product name: Recombinant human SIRPB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-181 aa of BC025286 Sequence: MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVREPALAPTAPLLVALLLGPKLLLVVGVSAIYICWKQKA Predict reactive species\nFull Name: signal-regulatory protein beta 1\nCalculated Molecular Weight: 43 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC025286\nGene Symbol: SIRPB1\nGene ID (NCBI): 10326\nRRID: AB_2188197\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00241\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869601648809,"sku":"11811-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11811-1-ap","provider":"Iright","version":"1.0","type":"link"}