{"product_id":"proteintech-11828-1-ap","title":"Proteintech, 11828-1-AP, EMCN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EMCN (11828-1-AP) by Proteintech is a Polyclonal antibody targeting EMCN in WB, ELISA applications with reactivity to human, mouse samples\n11828-1-AP targets EMCN in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, mouse kidney tissue,  mouse lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEndomucin (EMCN), also known as Endomucin 2 or Mucin 14, is a type I integral membrane glycoprotein that is endothelial-specific. EMCN is expressed on the surface of capillaries and venous and is highly expressed in highly vascularized tissues such as heart, kidney and lung (PMID: 29215001). Endomucin plays an important role in cell interaction, molecular cell signaling, angiogenesis and cell migration (PMID: 33532708). Since it is glycosylated, the apparent molecular weight of EMCN could be variable, ranging from 80 kDa to 120 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2396 Product name: Recombinant human EMCN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-178 aa of BC017781 Sequence: MELLQVTILFLLPSICSSNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKTKN Predict reactive species\nFull Name: endomucin\nCalculated Molecular Weight: 19 kDa, 27 kDa\nObserved Molecular Weight: 85 kDa\nGenBank Accession Number: BC017781\nGene Symbol: EMCN\nGene ID (NCBI): 51705\nRRID: AB_3085382\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9ULC0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869404942505,"sku":"11828-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11828-1-ap","provider":"Iright","version":"1.0","type":"link"}