{"product_id":"proteintech-11843-1-ap","title":"Proteintech, 11843-1-AP, RBP5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RBP5 (11843-1-AP) by Proteintech is a Polyclonal antibody targeting RBP5 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, rat, pig samples\n11843-1-AP targets RBP5 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human liver tissue,  pig liver tissue,  rat liver tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2485 Product name: Recombinant human RBP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-135 aa of BC029355 Sequence: MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR Predict reactive species\nFull Name: retinol binding protein 5, cellular\nCalculated Molecular Weight: 135 aa, 16 kDa\nObserved Molecular Weight: 16-18 kDa\nGenBank Accession Number: BC029355\nGene Symbol: RBP5\nGene ID (NCBI): 83758\nRRID: AB_2085321\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P82980\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887780909225,"sku":"11843-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11843-1-ap","provider":"Iright","version":"1.0","type":"link"}