{"product_id":"proteintech-11849-1-ap","title":"Proteintech, 11849-1-AP, SPATA6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPATA6 (11849-1-AP) by Proteintech is a Polyclonal antibody targeting SPATA6 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11849-1-AP targets SPATA6 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue,  mouse ovary tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSpermatogenesis-associated protein 6 (SPATA6) is a testis-enriched protein crucial for spermatogenesis and male fertility. It localizes to the sperm head-tail coupling apparatus (HTCA) and is crucial for the proper assembly of the sperm connecting piece and tight head-tail conjunction. SPATA6 is a core structural component of the sperm fibrous sheath (FS), a cytoskeletal structure in the principal piece of the sperm flagellum essential for normal sperm motility. Mutations in SPATA6 can lead to acephalic spermatozoa and male infertility (PMID: 38454159, PMID: 41058548).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2413 Product name: Recombinant human SPATA6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 167-472 aa of BC020660 Sequence: YHLAPVEKSHGRLQNRTSRSQKKKSKSPERSKYCINAKNYEQPTISSKSHSPSPYTKRRMCELSEDTRRRLAHLNLGPYEFKKETDKPPFVIRHVDPPSPRADTLLGSSGRDCERDGWSRVHNDHSHLGCCRPKDYKVIRTPHGRDFDDSLEKCEEYLSPRSCSKPRHSARTLLVHSAPSTMPKHSPSPVLNRASLRERFHSDWCSPSNCDEIHDRDERDLEKDDELELKRSLLCRDSAYDSDPEYSSCQQPRGTFHLDDGEYWSNRAASYKGKSHRPIFENSMDKMYRNLYKKACSSASHTQESF Predict reactive species\nFull Name: spermatogenesis associated 6\nCalculated Molecular Weight: 472 aa, 54 kDa\nObserved Molecular Weight: 54-60 kDa\nGenBank Accession Number: BC020660\nGene Symbol: SPATA6\nGene ID (NCBI): 54558\nRRID: AB_11232594\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NWH7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869385707689,"sku":"11849-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11849-1-ap","provider":"Iright","version":"1.0","type":"link"}