{"product_id":"proteintech-11868-1-ap","title":"Proteintech, 11868-1-AP, SH2D1A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SH2D1A (11868-1-AP) by Proteintech is a Polyclonal antibody targeting SH2D1A in WB, ELISA applications with reactivity to human, mouse, rat samples\n11868-1-AP targets SH2D1A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse thymus tissue,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSH2D1A, also named as DSHP and SAP, is an inhibitor of the SLAM self-association. It acts by blocking recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to a docking site in the SLAM cytoplasmic region. SH2D1A mediates interaction between FYN and SLAMF1. Defects in SH2D1A are a cause of lymphoproliferative syndrome X-linked type 1 (XLP1).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2450 Product name: Recombinant human SH2D1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC020732 Sequence: MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP Predict reactive species\nFull Name: SH2 domain protein 1A\nCalculated Molecular Weight: 128 aa, 14 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC020732\nGene Symbol: SH2D1A\nGene ID (NCBI): 4068\nRRID: AB_2239283\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60880\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869763195049,"sku":"11868-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11868-1-ap","provider":"Iright","version":"1.0","type":"link"}