{"product_id":"proteintech-11871-1-ap","title":"Proteintech, 11871-1-AP, SH2D1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SH2D1B (11871-1-AP) by Proteintech is a Polyclonal antibody targeting SH2D1B in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11871-1-AP targets SH2D1B in IHC, IF\/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSH2D1B, also named as EAT2, an adaptor expressed in innate immune cells, including natural killer (NK) cells. It plays a role in controlling signal transduction through at least four receptors, CD84, SLAMF1, LY9 and CD244, expressed on the surface of professional antigen-presenting cells. EAT-2 overexpression would enhance the innate immune responses and also result in more potent Carcinoembryonic antigen-specific adaptive immune responses.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2454 Product name: Recombinant human SH2D1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC022407 Sequence: MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP Predict reactive species\nFull Name: SH2 domain containing 1B\nCalculated Molecular Weight: 132 aa, 15 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC022407\nGene Symbol: SH2D1B\nGene ID (NCBI): 117157\nRRID: AB_10603473\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14796\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868960641193,"sku":"11871-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11871-1-ap","provider":"Iright","version":"1.0","type":"link"}