{"product_id":"proteintech-11888-1-ap","title":"Proteintech, 11888-1-AP, XLF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe XLF (11888-1-AP) by Proteintech is a Polyclonal antibody targeting XLF in WB, ELISA applications with reactivity to human samples\n11888-1-AP targets XLF in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nXRCC4-like factor (XLF), also known as Cernunnos and NHEJ1, is a protein encoded by the human NHEJ1 gene and an important repair factor for DNA double-strand breaks. NHEJ is a well-known mechanism for the repair of double-strand breaks (DSBs), a lethal type of DNA damage in mammalian cells. It basically utilizes a group of enzymes to take hold of the ends of a broken DNA molecule, create a bridge between them, and subsequently re-ligate the broken DNA molecule.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2496 Product name: Recombinant human NHEJ1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-299 aa of BC030986 Sequence: MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSAPTLSAPEKESTGTSGPLQRPQLSKVKRKKPRGLFS Predict reactive species\nFull Name: nonhomologous end-joining factor 1\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 33-38 kDa\nGenBank Accession Number: BC030986\nGene Symbol: XLF\nGene ID (NCBI): 79840\nRRID: AB_2282851\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H9Q4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869440856233,"sku":"11888-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11888-1-ap","provider":"Iright","version":"1.0","type":"link"}